PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_7.137
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 709aa    MW: 78281.9 Da    PI: 6.7482
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_7.137genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.7e-202479156
                                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                     Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                 +++ +++t++q++ Le+ F+ +++p++++r +L+++lgL  rq+k+WFqNrR+++k
  evm.model.supercontig_7.137 24 KKRYHRHTAHQIQKLESTFKDCPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMK 79
                                 678899***********************************************998 PP

2START173.71.2e-542234442206
                                  HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT- CS
                        START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWd 73 
                                  +a  a++el+++ + +ep+Wvkss    + ++ + + + f+++++       ++ea+r+sgvv+m++  lv  ++d + +W 
  evm.model.supercontig_7.137 223 IAANAMEELLRLLQTNEPLWVKSShdgrDVLDLESYHRMFPRANAhlknpnVRIEASRDSGVVIMNALALVDMFMDCN-KWV 303
                                  67889*******************888888888888888888877****999**************************.999 PP

                                  TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE CS
                        START  74 etla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvR 144
                                  e ++     a+t+ev+ssg      g lqlm+ elq+lsplv+ R+f ++Ry+rq ++g+w+iv vS d  q+++ + ++ R
  evm.model.supercontig_7.137 304 ELFPtmvsMAKTMEVLSSGmmgsraGSLQLMYEELQVLSPLVAtREFCILRYCRQVEQGSWAIVNVSYDFAQFVS-QCPSRR 384
                                  888888889*****************************************************************9.666666 PP

                                  -EESSEEEEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                        START 145 aellpSgiliepksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                                     lpSg+li++++ng++kvtwvehv+ ++++  h l+r l++sgla+ga +w+a  qr ce+
  evm.model.supercontig_7.137 385 ---LPSGCLIQDMPNGYCKVTWVEHVEIEDKTAvHRLYRELIHSGLAFGAERWMAIIQRMCER 444
                                  ...**************************99977***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.51E-20781IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-221183IPR009057Homeodomain-like
PROSITE profilePS5007117.9612181IPR001356Homeobox domain
SMARTSM003894.2E-192285IPR001356Homeobox domain
CDDcd000867.68E-192382No hitNo description
PfamPF000462.1E-172479IPR001356Homeobox domain
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PROSITE profilePS5084848.053213447IPR002913START domain
SuperFamilySSF559612.47E-37214445No hitNo description
CDDcd088752.90E-114217443No hitNo description
SMARTSM002343.8E-45222444IPR002913START domain
PfamPF018524.1E-47223444IPR002913START domain
Gene3DG3DSA:3.30.530.202.7E-8266411IPR023393START-like domain
SuperFamilySSF559615.39E-24465700No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MEYGSGGGSG SGGDHDASDP QRRKKRYHRH TAHQIQKLES TFKDCPHPDE KQRLQLSREL  60
GLAPRQIKFW FQNRRTQMKA QHERADNCAL RAENDKIRCE NIAIREALKN VICPSCGGPP  120
VTEDSYFDEH KLRMENAQLR EELDRVSSIA AKYIGRPITQ LPPVQPLHMS SLDLSIATLN  180
SQGFNGPSLD LDLLPCSSST DQPNLPFQHL VISDMDKSLM ADIAANAMEE LLRLLQTNEP  240
LWVKSSHDGR DVLDLESYHR MFPRANAHLK NPNVRIEASR DSGVVIMNAL ALVDMFMDCN  300
KWVELFPTMV SMAKTMEVLS SGMMGSRAGS LQLMYEELQV LSPLVATREF CILRYCRQVE  360
QGSWAIVNVS YDFAQFVSQC PSRRLPSGCL IQDMPNGYCK VTWVEHVEIE DKTAVHRLYR  420
ELIHSGLAFG AERWMAIIQR MCERFACLMV SGTSTRDLGG VIPSPDGKRS MMKLAQRMVN  480
NFCTSISTSS SHRWTTLSGF NEVGVRVSAH KSSDPGQPSG VVFSAATTFW LPVSPQNVFN  540
FFKDERTRPQ WDVLSNGNAV QEVAHIANGS HPGNCISVLR AFNTSQNNML ILQESCIDSS  600
GSLVVYCPVD LHAINIAMSG EDPSYIPLLP SGFTISSDGQ SQQGDGASSS SSNVLGNSSS  660
GSLITVAFQI LVSSLPSAKL NMESVETVNN LIGTTVQQIK SALNCPAS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006478112.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A0D2UBV50.0A0A0D2UBV5_G
STRINGPOPTR_0015s05050.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11